PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G16510.1
Common NameLOC102701630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 379aa    MW: 42240.1 Da    PI: 6.0214
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G16510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like47.83.1e-15173222455
       G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   l Wtp L ++F++a+e L G+  A Pk+i+ +m+v+ + + +++ HLQk+Rl
  OB04G16510.1 173 LMWTPHLQKKFLDALEIL-GE-DASPKKIKMIMDVDNIDRRQIATHLQKHRL 222
                   78****************.55.5****************************8 PP

2Response_reg46.42.1e-16151222107
                   EEESSSHHHHHHHHHHHH.HTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   2 livdDeplvrellrqale.kegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +++d+++  ++    +l+ + ++  v++++++ +al+ l+++   ++l+l D+ m +m+G+e++k  r+ ++++++i+++++ ++ +++ + ++Ga+
  OB04G16510.1  15 MVIDEDKCHANSTSCMLSaELNF-CVRVFTSPLKALDFLQNHAegVGLVLADVHMEEMNGFEFMKAARKLHKSIQVIMMSTEITMYTMKMCAELGAR 110
                   78999999999999999999999.9*****************999**************************************************** PP

                   EEEESS--HHHH CS
  Response_reg  96 dflsKpfdpeel 107
                     + Kp+d   +
  OB04G16510.1 111 FLVKKPVDVGTI 122
                   ******997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.13E-2011129IPR011006CheY-like superfamily
SMARTSM004481.7E-812126IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.1E-2012129No hitNo description
PROSITE profilePS5011023.47513130IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.20E-1315118No hitNo description
PfamPF000721.2E-1415123IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466891.57E-13168225IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-16168225IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-15173223IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MAQKEVLPAG RISAMVIDED KCHANSTSCM LSAELNFCVR VFTSPLKALD FLQNHAEGVG  60
LVLADVHMEE MNGFEFMKAA RKLHKSIQVI MMSTEITMYT MKMCAELGAR FLVKKPVDVG  120
TIQSLWQHLD LKVLRTEKIK DLLRGVGDKS TCDSEMNSFA NNQKDDNKKK YYLMWTPHLQ  180
KKFLDALEIL GEDASPKKIK MIMDVDNIDR RQIATHLQKH RLKLKMKLNK ALFTNGSSNG  240
SSNSGTEPAE SHPRCRSTTL QPHPCSAQAA KITMQILPED DDEHDDIYAA MRRALQDRTV  300
FDECQYSMDP CGDEHDVGGG YGCAGEANAR DSSSGDHHQV AAVAEEDMIN NMPSPEDMQA  360
TRGKAPVFSL VDYSDSESG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6629634e-52AL662963.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0020I02, complete sequence.
GenBankAP0149604e-52AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126124e-52CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691407.10.0PREDICTED: two-component response regulator ORR29-like
SwissprotB8ASH80.0ORR29_ORYSI; Two-component response regulator ORR29
TrEMBLJ3LWX60.0J3LWX6_ORYBR; Uncharacterized protein
STRINGOB04G16510.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59202345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-16response regulator 12